PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016307
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family BES1
Protein Properties Length: 326aa    MW: 35490.5 Da    PI: 9.7851
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016307genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822203.56.2e-63121522143
       DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                  + +rkp+w+ErEnn+rRERrRRa aaki++GLRaqGny+lpk++DnneVlkALc+eAGwvve+DGttyrkg +p+    ++ ssa+++p ss+++s+ 
  Lus10016307  12 APRRKPSWRERENNRRRERRRRATAAKIFTGLRAQGNYNLPKHCDNNEVLKALCHEAGWVVEEDGTTYRKGHRPPPLDIVGASSARVTPYSSQNQSPM 109
                  669************************************************************************44445556677999***99**** PP

       DUF822 100 ssalaspvesysaspksssfpspssldsislasaasllpvlsvl 143
                  ss ++sp++sy+ sp+sssfpsps+++++++  ++ ++p++++ 
  Lus10016307 110 SSLFPSPIPSYQVSPSSSSFPSPSRVENNNNP-PSAIFPFFRNS 152
                  **************************999875.67777877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.1E-5914138IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MTSDGATSTA AAPRRKPSWR ERENNRRRER RRRATAAKIF TGLRAQGNYN LPKHCDNNEV  60
LKALCHEAGW VVEEDGTTYR KGHRPPPLDI VGASSARVTP YSSQNQSPMS SLFPSPIPSY  120
QVSPSSSSFP SPSRVENNNN PPSAIFPFFR NSIPSSLPPL RISNSAPVTP PMSSPNSRNH  180
KPILPNWDSI ARQSMASLNN NYPLYAASAP SSPTHRQFHA PATIPECDES DTSSTVESGQ  240
WISFQKFAPA AAMAAAMPPA SPTYNLVKPV PQQGLLSHDT IMGESGRSME FEFGNGRVKA  300
WEGERIHEVG VDDLELTLGN GKGRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11332RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510347.11e-152PREDICTED: protein BRASSINAZOLE-RESISTANT 1
SwissprotQ8S3071e-137BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLB9R7Q41e-152B9R7Q4_RICCO; BRASSINAZOLE-RESISTANT 1 protein, putative
STRINGPOPTR_0014s04110.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-114BES1 family protein